PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629405.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 385aa    MW: 43319.7 Da    PI: 8.6531
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629405.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32210263255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_013629405.1 210 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 263
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15207263IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28208263IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-24210263IPR006447Myb domain, plants
PfamPF002495.4E-7211262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSMEGVFLEK PTSNTTTTLP DLSLNISLPD THHNESSKEL SRRSSQTDNN RSSNFELSLS  60
HHNNPSSNPS TRIIHCPDRR NLYNNHILNG GSLHQRVDES EINNIHRPIR GIPVYHNRSF  120
PFHQQASPSS LPSLGGDFSI LNSSSGYNNA YRLFQSSPRL KGVPMHHHNH YGVVGSSDSS  180
YPHHHNHHHH GMVRSRFLPK MPTKRSMRAP RMRWTSSLHA RFVHAVELLG GHERATPKSV  240
LELMDVKDLT LAHVKSHLQM YRTVKTTNKP AASSDGSGEE EMGINGNERA QSDDTSPHQE  300
IDFPSTTQPR WSNSSGETWP LSNNCASDID TVIRTSSTSV ISHHQRTSLQ NQDQRSNDQG  360
KRCGDLSCNN PSLEFTLGRP DWHEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0301920.0AY030192.1 Arabidopsis thaliana clone A1-2 KANADI protein (KAN) mRNA, complete cds.
GenBankAY0486880.0AY048688.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI1 (KAN1) mRNA, complete cds.
GenBankBT0264360.0BT026436.1 Arabidopsis thaliana At5g16560 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629405.10.0PREDICTED: transcription repressor KAN1-like
SwissprotQ93WJ90.0KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A0D3B1H90.0A0A0D3B1H9_BRAOL; Uncharacterized protein
STRINGAT5G16560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.10.0G2-like family protein